$0.00
Cysteine-Streptavidin His tag
$350.00
Description
Product overview
Cysteine-streptavidin (Cys-streptavidin) is an engineered streptavidin that contains a cysteine residue at the n-terminus. Cysteine-streptavidin has four identical subunits and binds specifically to biotin with an extremely high affinity. In addition, the unique cysteine residue offers site-specific conjugation. Hence, cysteine-streptavidin can create a conjugate with an optimum molar ratio. Moreover, the cys-streptavidin protein has a C-terminal polyhistidine tag to purify streptavidin and conjugates under mild conditions. Furthermore, it is expressed by our unique SoluPrx technology and purified from PBS-soluble fractions.
Product specification
| Name | Cys-Streptavidin (His-tag) |
| Accession No. | P22629 |
| Target Protein Sequence | DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRY DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAW KSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Tag Info | His-tag |
| Molecular Weight | 17.9 kDa (Monomer) |
| Source | Recombinant fusion protein from E.coli |
| Amount | 2.0 mg |
| Concentration | >2.0 mg/ml |
| Purity | ≥ 95% by SDS-PAGE |
| Form | Liquid |
| Buffer | 20 mM HEPES, 0.5 mM TCEP, pH7.0 |
| Endotoxin level | not determined |
| Application | In vitro research use only |
| Other Features | Site-specific conjugation |
| Datasheet & COA | Please contact us to get it. |
Delivery and storage
| Delivery | Cold packs |
| Short Term Storage | -20°C |
| Long Term Storage | -20°C |
| Other Notes | Avoid freeze/thaw cycle. Aliquot upon arrival |
Advantages of Cysteine-Streptavidin (His-tag)
| Characteristics | Cysteine-streptavidin (His-tag) | Streptavidin |
| Biotin binding Site | 4 | 4 |
| Source | E.coli | Streptomyces avidinii |
| Dissociation Constant | 10-14mol/L | 10-14mol/L |
| Conjugation | N-terminal Cys (site-specific) | lysine (random) |
| Fusion tag | 8 × His-tag | No |
| Elution | Neutral pH (PBS-imidazole) | Acidic (pH 4.0) |
Application of Cysteine-Streptavidin (His-tag)
Features
•High affinity for biotin
•High specificity for biotin
•Site-specific conjugation due to the single cysteine
•Mild purification due to the 8 x His tag
Site-specific conjugation of Cysteine-streptavidin (His-tag)
•Enzyme (HRP, phosphatase, beta-galactosidase, luciferase, glucose oxidase)
•Dye (FITC, Cy5, Cy3, Alexa, ATTO, DyLight)
•Fluorescent protein (R-PE, B-PE, APC, PerCP, GFP, RFP)
•Oligonucleotide
•Solid support (agarose, gold particle)
For more information, please click here or email in**@*******os.com.
