$0.00
PA-I galactophilic lectin (lecA), Recombinant
$350.00
Description
Product Overview
The PA-I galactophilic lectin (lecA) is a recombinant galactose binding protein from Pseudomonas aeruginosa. It binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. The PA-I galactophilic lectin (lecA) protein has an N-terminal 7 x His tag.
Product specification
| Name | PA-I galactophilic lectin (lecA), recombinant |
| Accession No. | Q05097 |
| Target Protein Sequence | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVM KIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| Tag Info | 7 x His-tag |
| Molecular Weight | 14.2 kDa |
| Source | Recombinant protein from E.coli |
| Amount | 50 μg |
| Concentration | 0.5-1.0 mg/ml |
| Purity | ≥ 95% by SDS-PAGE |
| Form | Liquid |
| Buffer | 10 mM PBS buffer-50% glycerol, pH 7.2 |
| Endotoxin level | not determined |
| Application | In vitro research use only |
| Other Features | Galactose-binding lectin |
| Typical Gel image |  |
| Datasheet & COA | Please contact us to get it. |
Delivery and storage
| Delivery | Cold packs |
| Short Term Storage | -20°C |
| Long Term Storage | -20°C |
| Other Notes | Avoid freeze/thaw cycle. Aliquot upon arrival |
For bulk orders, please click here or email in**@*******os.com.
Cleavage of Protein
1. Prepare the target protein (1-2 mg/ml) in cleavage buffer by dialysis. An example of cleavage buffer is 50 mM Tris-HCl, pH 8.0, 150 NaCl, 1 mM DTT.
2. Add HRV3C Protease to the target protein. 1000 units of HRV3C Protease can cleave 100 mg of target protein. Other Protease-to-target protein ratios (w/w) of 1:50 to 1:200 should work for most target proteins.
3. Incubate the cleavage reaction overnight at 4°C for complete cleavage.
